PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G331100.1.p
Common NameSb03g037680, SORBIDRAFT_03g037680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 557aa    MW: 60191.8 Da    PI: 4.9008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G331100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-164794148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  Sobic.003G331100.1.p 47 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 94
                          79******************************************9986 PP

2Myb_DNA-binding52.71e-16100143146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g++T+eE+ l++++++++G++ W++ a++++ gRt++++k++w++
  Sobic.003G331100.1.p 100 KGAFTPEEERLIIQLHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 143
                           799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016937.8E-2471556IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.6254294IPR017930Myb domain
SuperFamilySSF466894.87E-3144141IPR009057Homeodomain-like
SMARTSM007172.1E-144696IPR001005SANT/Myb domain
PfamPF002491.1E-144794IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2348101IPR009057Homeodomain-like
CDDcd001672.71E-114994No hitNo description
PROSITE profilePS5129425.65695149IPR017930Myb domain
SMARTSM007172.1E-1799147IPR001005SANT/Myb domain
PfamPF002496.9E-16100143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-26102147IPR009057Homeodomain-like
CDDcd001677.14E-13102143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MYRVKSEGEG DCEMMLQDQM DSPVADDVSS GGGSPHPHRG AGPPLKKGPW TSAEDAILVD  60
YVKKHGEGNW NAVQKNTGLF RCGKSCRLRW ANHLRPNLKK GAFTPEEERL IIQLHAKMGN  120
KWARMAAHLP GRTDNEIKNY WNTRIKRCQR ASLPIYPASV CNQSSNEDQQ VSGDYNGGEN  180
ISNDLLSGNS LYLPDFTSDN FIANPEALSY APQLSAVSIS NLLGQSFASK NCSFMDQVDQ  240
AGMLKQSSCV LPALSDAIDG VLSSVDQFSN DSEKLKQALG FDYLNEANAS SKSIAPFGVA  300
LTGSHAFLNG NFSASRPTNG PLKMELPSLQ DTESDPNSWL KYTVAPAMQP TELVDPYLQS  360
PSATPSVKSE CASPRNSGLL EELLHEAQAL RSGKNQQPSV RSSSSSAGTP CETTTVVSPE  420
FDMGQEYWEE QPGSFLSEYA HFSGNSLTES TPVSAASPDF FQFSKISPAQ SPSMGSGEQA  480
LEPKHESAAS PHPENLRPDA LFSGNTADPS IFNNAIAMLM GNGINAEYKH VLGDGVVLDS  540
SSWNNMPHAF QMTEFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32431473106B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.104520.0callus| embryo| panicle| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9708860.0EU970886.1 Zea mays clone 353123 transcription factor GAMYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456516.10.0hypothetical protein SORBIDRAFT_03g037680
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLC5XN470.0C5XN47_SORBI; Putative uncharacterized protein Sb03g037680
STRINGSb03g037680.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.36e-84myb domain protein 33